PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.06G303700.1.p
Common NameGLYMA_06G303700, LOC100790101
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 730aa    MW: 79507.9 Da    PI: 5.6421
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.06G303700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.41.6e-2055110156
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
  Glyma.06G303700.1.p  55 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMK 110
                          688999***********************************************999 PP

2START224.53.3e-702464661206
                          HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.... CS
                START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla.... 77 
                          ela +a++el+ +a+ +ep+W +      +++n+de++++f+++ +     ++ ea+r+++vv+m++++lve+l+d++ qW++ +     
  Glyma.06G303700.1.p 246 ELAVAAMEELIGMAQMGEPLWLTTLdgtsTMLNEDEYIRSFPRGIGpkpsgFKCEASRETAVVIMNHVNLVEILMDVN-QWSTVFSgivs 334
                          57899**************************************999********************************.*********** PP

                          EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTC CS
                START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksng 160
                          +a+tlev+s+g      galq+m+aelq+++plvp R+++fvRy++q+g+g+w++vdvS+d+ ++ p    ++R++++pSg+li++++ng
  Glyma.06G303700.1.p 335 RAMTLEVLSTGvagnynGALQVMTAELQLPTPLVPtRESYFVRYCKQHGDGTWAVVDVSLDNLRPSP----SARCRRRPSGCLIQEMPNG 420
                          *****************************************************************99....5****************** PP

                          EEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 161 hskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                          +skvtwvehv++++r +h+l+++lv+sg+a+gak+ vatl+rqce+
  Glyma.06G303700.1.p 421 YSKVTWVEHVEVDDRGVHNLYKQLVSSGHAFGAKRLVATLDRQCER 466
                          ********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-2334110IPR009057Homeodomain-like
SuperFamilySSF466891.55E-1944112IPR009057Homeodomain-like
PROSITE profilePS5007116.92552112IPR001356Homeobox domain
SMARTSM003891.2E-1953116IPR001356Homeobox domain
PfamPF000464.1E-1855110IPR001356Homeobox domain
CDDcd000862.48E-1955113No hitNo description
PROSITE patternPS00027087110IPR017970Homeobox, conserved site
SuperFamilySSF559614.55E-35237468No hitNo description
PROSITE profilePS5084843.079237469IPR002913START domain
CDDcd088752.09E-128241465No hitNo description
SMARTSM002345.4E-64246466IPR002913START domain
PfamPF018523.2E-59247466IPR002913START domain
Gene3DG3DSA:3.30.530.201.3E-5340435IPR023393START-like domain
SuperFamilySSF559615.5E-26485721No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 730 aa     Download sequence    Send to blast
MFQPNLMDAL EMGQNTPESE IPRIREDEFD SATKSGSENH EGASGEDQDP RPNKKKRYHR  60
HTQHQIQEME AFFKECPHPD DKQRKELSRE LGLEPLQVKF WFQNKRTQMK TQHERHENTN  120
LRTENEKLRA DNMRYREALS NASCPNCGGP TAIGEMSFDE HHLRLENARL REEIDRISAI  180
AAKYVGKPVV NYSNISPSLP PRPLEIGVGG AGFGGQPGIG VDMYGAGDLL RSISGPTEAD  240
KPIIIELAVA AMEELIGMAQ MGEPLWLTTL DGTSTMLNED EYIRSFPRGI GPKPSGFKCE  300
ASRETAVVIM NHVNLVEILM DVNQWSTVFS GIVSRAMTLE VLSTGVAGNY NGALQVMTAE  360
LQLPTPLVPT RESYFVRYCK QHGDGTWAVV DVSLDNLRPS PSARCRRRPS GCLIQEMPNG  420
YSKVTWVEHV EVDDRGVHNL YKQLVSSGHA FGAKRLVATL DRQCERLASA MATNIPTVDV  480
GVITNQEGRK SMMKLAERMV ISFCAGVSAS TAHTWTTLSG TGADDVRVMT RKSVDDPGRP  540
PGIVLSAATS FWLPVPPKRV FDFLRDENSR NEWDILSNGG VVQEMAHIAN GRDTGNCVSL  600
LRVNSANSSQ SNMLILQESC TDSTGSFVIY APVDIVAMNV VLNGGDPDYV ALLPSGFAIL  660
PDGTTSHGSG GGVIGETSPS SGSLLTVAFQ ILVDSVPTAK LSLGSVATVN NLIACTVERI  720
KASLSGEPA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.380960.0leaf| somatic embryo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003527487.10.0PREDICTED: homeobox-leucine zipper protein HDG2-like isoform X2
SwissprotQ94C370.0HDG2_ARATH; Homeobox-leucine zipper protein HDG2
TrEMBLI1KFB60.0I1KFB6_SOYBN; Uncharacterized protein
STRINGGLYMA06G46000.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15083499
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.40.0homeodomain GLABROUS 2